Germany
Japan
United Kingdom
China
MMP19 Rabbit Polyclonal Antibody
Product Images
Other products for "MMP19"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | WB, IHC |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MMP19 antibody: synthetic peptide directed towards the N terminal of human MMP19. Synthetic peptide located within the following region: ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 56 kDa |
| Gene Name | matrix metallopeptidase 19 |
| Database Link | |
| Background | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene. |
| Synonyms | MMP18; RASI-1 |
| Note | Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86% |
| Reference Data | |
| Protein Families | Protease, Secreted Protein |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.