PSMD4 Rabbit Polyclonal Antibody

CAT#: TA330260

Rabbit Polyclonal Anti-PSMD4 Antibody

Product Images

WB Suggested Anti-PSMD4 Antibody Titration: 0.3ug/ml; Positive Control: Raji cell lysatePSMD4 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSMD4 antibody: synthetic peptide directed towards the N terminal of human PSMD4. Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: proteasome 26S subunit, non-ATPase 4
• Database Link:
  NP_002801
  Entrez Gene 5710 Human
  UniProt ID P55036
• Background: PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid which is part of a multicatalytic proteinase complex of the 26S proteasome.
• Synonyms: AF; AF-1; ASF; MCB1; pUB-R5; Rpn10; S5A
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 79%

Reference Data

• Protein Pathways: Proteasome