RUVBL2 Rabbit Polyclonal Antibody

CAT#: TA330273

Rabbit Polyclonal Anti-RUVBL2 Antibody

Product Images

WB Suggested Anti-RUVBL2 Antibody ; Positive Control: siRUVBL2 transfected H1299 cells

• 

  WB Suggested Anti-RUVBL2 Antibody Titration: 2.0-4.0ug/ml; Positive Control: Daudi cell lysateRUVBL2 is supported by BioGPS gene expression data to be expressed in Daudi

• 

  Human Lung

• 

  Human urinary bladder

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: RuvB like AAA ATPase 2
• Database Link:
  NP_006657
  Entrez Gene 10856 Human
  UniProt ID Q9Y230
• Background: RuvB-Like 2 (48-kDa TATA box-binding protein-interacting protein, Reptin 52, RUVBL2) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this protein has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
• Synonyms: CGI-46; ECP51; INO80J; REPTIN; RVB2; TIH2; TIP48; TIP49B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 79%

Reference Data

• Protein Families: Transcription Factors