RUVBL2 Rabbit Polyclonal Antibody

CAT#: TA330274

Rabbit Polyclonal Anti-RUVBL2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RUVBL2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name RuvB like AAA ATPase 2
Background RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.
Synonyms CGI-46; ECP51; INO80J; REPTIN; RVB2; TIH2; TIP48; TIP49B
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.