SIRT6 Rabbit Polyclonal Antibody

CAT#: TA330291

Rabbit Polyclonal Anti-SIRT6 Antibody

Product Images

WB Suggested Anti-SIRT6 Antibody Titration: 1.25ug/ml; Positive Control: HepG2 cell lysate

• 

  U2OS

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: sirtuin 6
• Database Link:
  NP_057623
  Entrez Gene 50721 MouseEntrez Gene 51548 Human
  UniProt ID Q8N6T7
• Background: SIRT6 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT6 is included in class IV of the sirtuin family.
• Synonyms: SIR2L6
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 93%; Horse: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors