CACNB3 Rabbit Polyclonal Antibody

CAT#: TA330294

Rabbit Polyclonal Anti-CACNB3 Antibody

Product Images

Host: Rabbit; Target Name: CACNB3; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: calcium voltage-gated channel auxiliary subunit beta 3
• Database Link:
  NP_001193846
  Entrez Gene 784 Human
  UniProt ID P54284
• Background: The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
• Synonyms: CAB3; CACNLB3
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway