AIF (AIFM1) Rabbit Polyclonal Antibody

CAT#: TA330318

Rabbit Polyclonal Anti-AIFM1 Antibody

Product Images

WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateAIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: apoptosis inducing factor, mitochondria associated 1
• Database Link:
  NP_665811
  Entrez Gene 9131 Human
  UniProt ID O95831
• Background: AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.
• Synonyms: AIF; CMT2D; CMTX4; COWCK; COXPD6; NADMR; NAMSD; PDCD8
• Note: Immunogen sequence homology: Sheep:100%; Human:100%; Bovine:86%; Dog:85%; Cat:85%; Sartorya fumigata:83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Apoptosis