Osteoprotegerin (TNFRSF11B) Rabbit Polyclonal Antibody

CAT#: TA330320

Rabbit Polyclonal Anti-TNFRSF11B Antibody

Product Images

WB Suggested Anti-TNFRSF11B Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNFRSF11B antibody: synthetic peptide directed towards the N terminal of human TNFRSF11B. Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: tumor necrosis factor receptor superfamily member 11b
• Database Link:
  NP_002537
  Entrez Gene 4982 Human
  UniProt ID O00300
• Background: TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand (TNFSF11/OPGL), both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
• Synonyms: OCIF; OPG; TR1
• Note: Immunogen sequence homology: Human: 100%; Mouse: 85%; Dog: 78%; Horse: 78%; Pig: 78%; Rabbit: 78%; Rat: 78%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction