Osteoprotegerin (TNFRSF11B) Rabbit Polyclonal Antibody

CAT#: TA330320

Rabbit Polyclonal Anti-TNFRSF11B Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TNFRSF11B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TNFRSF11B antibody: synthetic peptide directed towards the N terminal of human TNFRSF11B. Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 46 kDa
Gene Name tumor necrosis factor receptor superfamily member 11b
Background TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand (TNFSF11/OPGL), both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
Synonyms OCIF; OPG; TR1
Note Immunogen sequence homology: Human: 100%; Mouse: 85%; Dog: 78%; Horse: 78%; Pig: 78%; Rabbit: 78%; Rat: 78%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.