DRAK1 (STK17A) Rabbit Polyclonal Antibody

CAT#: TA330331

Rabbit Polyclonal Anti-STK17A Antibody

Product Images

WB Suggested Anti-STK17A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: serine/threonine kinase 17a
• Database Link:
  NP_004751
  Entrez Gene 9263 Human
  UniProt ID Q9UEE5
• Background: STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.
• Synonyms: DRAK1
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Guinea pig: 93%; Chicken: 88%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase