RIP (RIPK1) Rabbit Polyclonal Antibody

CAT#: TA330334

Rabbit Polyclonal Anti-RIPK1 Antibody

Product Images

WB Suggested Anti-RIPK1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Lanes: Lane 1: 10ug 293 (Trex)FlpIn-RIPK1-HA-Strep (-Doxycycline)-non induced; Lane 2: 10ug 293 (Trex)FlpIn-RIPK1-HA-Strep (+Doxycycline)-induced; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:2000; G

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: receptor interacting serine/threonine kinase 1
• Database Link:
  NP_003795
  Entrez Gene 8737 Human
  UniProt ID Q13546
• Background: FAK overexpression in human tumors provides a survival signal function by binding to RIP and inhibiting its interaction with the death receptor complex.
• Synonyms: RIP; RIP-1; RIP1
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Dog: 91%; Horse: 83%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Apoptosis, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway