RIP2 (RIPK2) Rabbit Polyclonal Antibody

CAT#: TA330339

Rabbit Polyclonal Anti-RIPK2 Antibody

Product Images

WB Suggested Anti-RIPK2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Sample Type : Rat thyrocytes-FRTL-5 Primary Antibody Dilution : 1:100 Secondary Antibody : Anti-rabbit-Texas Red Secondary Antibody Dilution : 1:100 Color/Signal Descriptions : Red: RIPK2 Blue: DAPIGene Name : RIPK2 Submitted by : Syed A Morshed, Mount Si

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RIPK2 antibody: synthetic peptide directed towards the middle region of human RIPK2. Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: receptor interacting serine/threonine kinase 2
• Database Link:
  NP_003812
  Entrez Gene 362491 RatEntrez Gene 8767 Human
  UniProt ID O43353
• Background: RIPK2 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. It contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CARD3; CARDIAK; CCK; GIG30; RICK; RIP2
• Note: Immunogen sequence homology: Bovine: 85%; Dog: 85%; Horse: 85%; Human: 85%; Rabbit: 84%; Chicken: 78%; Guinea pig: 78%; Mouse: 78%; Rat: 78%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Neurotrophin signaling pathway, NOD-like receptor signaling pathway