14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody

CAT#: TA330344

Rabbit Polyclonal Anti-YWHAH Antibody

Product Images

WB Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

• 

  IHC Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human brain

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
• Database Link:
  NP_003396
  Entrez Gene 7533 Human
  UniProt ID Q04917
• Background: The YWHAH gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: YWHA1
• Note: Immunogen sequence homology: Chicken: 100%; Dog: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 93%; Zebrafish: 78%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis