Cyclin G2 (CCNG2) Rabbit Polyclonal Antibody

CAT#: TA330363

Rabbit Polyclonal Anti-CCNG2 Antibody

Product Images

WB Suggested Anti-CCNG2 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNG2 antibody: synthetic peptide directed towards the N terminal of human CCNG2. Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: cyclin G2
• Database Link:
  NP_004345
  Entrez Gene 901 Human
  UniProt ID Q16589
• Background: The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.
• Synonyms: cyclin G2; OTTHUMP00000160592
• Note: Immunogen sequence homology: Human: 100%; Bovine: 91%; Dog: 91%; Mouse: 83%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: p53 signaling pathway