Cyclin A2 (CCNA2) Rabbit Polyclonal Antibody

CAT#: TA330368

Rabbit Polyclonal Anti-CCNA2 Antibody

Product Images

WB Suggested Anti-CCNA2 Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysateCCNA2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: cyclin A2
• Database Link:
  NP_001228
  Entrez Gene 890 Human
  UniProt ID P20248
• Background: Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
• Synonyms: CCN1; CCNA
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Dog: 91%; Horse: 91%; Mouse: 91%; Rat: 91%; Chicken: 83%; Zebrafish: 81%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, Progesterone-mediated oocyte maturation