Cyclin A2 (CCNA2) Rabbit Polyclonal Antibody

CAT#: TA330368

Rabbit Polyclonal Anti-CCNA2 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CCNA2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name cyclin A2
Background Cyclin A is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
Synonyms CCN1; CCNA
Note Immunogen sequence homology: Bovine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Dog: 91%; Horse: 91%; Mouse: 91%; Rat: 91%; Chicken: 83%; Zebrafish: 81%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle, Progesterone-mediated oocyte maturation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.