E3 ubiquitin protein ligase MUL1 (MUL1) Rabbit Polyclonal Antibody

CAT#: TA330465

Rabbit Polyclonal Anti-MUL1 Antibody

Product Images

WB Suggested Anti-C1orf166 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166. Synthetic peptide located within the following region: KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: mitochondrial E3 ubiquitin protein ligase 1
• Database Link:
  NP_078820
  Entrez Gene 79594 Human
  UniProt ID Q969V5
• Background: The function of C1orf166 remains unknown.
• Synonyms: C1orf166; GIDE; MAPL; MULAN; RNF218
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane