MARCH8 Rabbit Polyclonal Antibody

CAT#: TA330501

Rabbit Polyclonal Anti-MARCH8 Antibody

Product Images

WB Suggested Anti-MARCH8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MARCH8 antibody: synthetic peptide directed towards the middle region of human MARCH8. Synthetic peptide located within the following region: YVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: membrane associated ring-CH-type finger 8
• Database Link:
  NP_659458
  Entrez Gene 220972 Human
  UniProt ID Q5T0T0
• Background: MARCH8 is an E3 ubiquitin-protein ligase that may regulate immune responses by promoting ubiquitination of MHC-II and CD86, which leads to their subsequent endocytosis and lysosomal degradation. It may also promote ubiquitination and endocytosis of TFRC and FAS. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
• Synonyms: c-MIR; CMIR; MARCH-VIII; MIR; RNF178
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane