CTBP1 Rabbit Polyclonal Antibody

CAT#: TA330555

Rabbit Polyclonal Anti-CTBP1 Antibody

Product Images

WB Suggested Anti-CTBP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysateCTBP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Pancreas

• 

  Human Pineal Tissue

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: C-terminal binding protein 1
• Database Link:
  NP_001319
  Entrez Gene 13016 MouseEntrez Gene 1487 Human
  UniProt ID Q13363
• Background: The phosphoprotein C-terminal binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptional repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.
• Synonyms: BARS
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%

Reference Data

• Protein Pathways: Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway