HP1 alpha (CBX5) Rabbit Polyclonal Antibody

CAT#: TA330563

Rabbit Polyclonal Anti-CBX5 Antibody

Product Images

WB Suggested Anti-CBX5 Antibody Titration: 1.25ug/ml; Positive Control: Human brain

• 

  Sample Type: 1. Human NT-2 cells (60ug); Primary Antibody Dilution:�2ug/ml; Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience; Secondary Antibody Dilution:�1: 20,000; Image Submitted by: Yuzhi Chen; University of Arkansas for Med

• 

  Sample Type : Human NT-2 cells Primary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution : 1:1000Color/Signal Descriptions : CBX5: Red DAPI:BlueGene Name : CBX5Submitted by : Dr. Yuzhi Chen, Universi

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CBX5 antibody: synthetic peptide directed towards the middle region of human CBX5. Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: chromobox 5
• Database Link:
  NP_036249
  Entrez Gene 23468 Human
  UniProt ID P45973
• Background: CBX5 is a methyl-lysine binding protein localized at heterochromatin sites, where it mediates gene silencing.
• Synonyms: HEL25; HP1; HP1A
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%