PTF1A Rabbit Polyclonal Antibody

CAT#: TA330585

Rabbit Polyclonal Anti-PTF1A Antibody

Product Images

WB Suggested Anti-PTF1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: pancreas specific transcription factor, 1a
• Database Link:
  NP_835455
  Entrez Gene 256297 Human
  UniProt ID Q7RTS3
• Background: PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas. This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: bHLHa29; PACA; PAGEN2; PTF1-p48
• Note: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Mouse: 86%; Yeast: 75%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS