Mohawk homeobox (MKX) Rabbit Polyclonal Antibody

CAT#: TA330613

Rabbit Polyclonal Anti-MKX Antibody

Product Images

WB Suggested Anti-MKX Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

• 

  Human Stomach

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX. Synthetic peptide located within the following region: IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: mohawk homeobox
• Database Link:
  NP_775847
  Entrez Gene 283078 Human
  UniProt ID Q8IYA7
• Background: MKX contains 1 homeobox DNA-binding domain and belongs to the TALE/IRO homeobox family. It may act as a morphogenetic regulator of cell adhesion.
• Synonyms: C10orf48; IFRX; IRXL1
• Note: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 92%; Mouse: 92%; Zebrafish: 85%

Reference Data

• Protein Families: Transcription Factors