HIPK2 Rabbit Polyclonal Antibody

CAT#: TA330617

Rabbit Polyclonal Anti-HIPK2 Antibody

Product Images

WB Suggested Anti-HIPK2 Antibody Titration: 0.1ug/ml; Positive Control: Jurkat Cell Lysate

• 

  WB Suggested Anti-HIPK2 Antibody Titration: 0.06ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysateHIPK2 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Host: Rabbit; Target Name: HIPK2; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1.0ug/mL; Peptide Concentration: 1.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 6%-18%HI

• 

  Rabbit Anti-HIPK2 Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-HIPK2 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-HIPK2 Antibody; Paraffin Embedded Tissue: Human neural cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• Rabbit Anti-HIPK2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Nuclear in pinealocytes & intersticial cells; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Secondary Antibody: Don

Show all 7 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HIPK2 antibody is: synthetic peptide directed towards the middle region of Human HIPK2. Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 120 kDa
• Gene Name: homeodomain interacting protein kinase 2
• Database Link:
  NP_073577
  Entrez Gene 15258 MouseEntrez Gene 28996 Human
  UniProt ID Q9H2X6
• Background: HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
• Synonyms: PRO0593
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 87%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transcription Factors