C5orf45 (MRNIP) Rabbit Polyclonal Antibody

CAT#: TA330650

Rabbit Polyclonal Anti-C5orf45 Antibody

Product Images

Host: Rabbit; Target Name: C5orf45; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C5orf45 antibody is: synthetic peptide directed towards the N-terminal region of Human C5orf45. Synthetic peptide located within the following region: QGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: chromosome 5 open reading frame 45
• Database Link:
  NP_057259
  Entrez Gene 51149 Human
  UniProt ID Q6NTE8
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp686L2452; MGC65027; MGC78537
• Note: Human: 100%