ANKRD16 Rabbit Polyclonal Antibody

CAT#: TA330657

Rabbit Polyclonal Anti-ANKRD16 Antibody

Product Images

Host: Rabbit; Target Name: ANKRD16; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ANKRD16 antibody is: synthetic peptide directed towards the N-terminal region of Human ANKRD16. Synthetic peptide located within the following region: CAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: ankyrin repeat domain 16
• Database Link:
  NP_061919
  Entrez Gene 54522 Human
  UniProt ID Q6P6B7
• Background: The function of this protein remains unknown.
• Synonyms: ankyrin repeat domain 16; OTTHUMP00000019019; OTTHUMP00000044872
• Note: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%; Zebrafish: 82%