TCTN2 Rabbit Polyclonal Antibody

CAT#: TA330754

Rabbit Polyclonal Anti-TCTN2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TCTN2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TCTN2 antibody is: synthetic peptide directed towards the N-terminal region of Human TCTN2. Synthetic peptide located within the following region: VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 73 kDa
Gene Name tectonic family member 2
Background This gene encodes a type I membrane protein that belongs to the tectonic family. Studies in mice suggest that this protein may be involved in hedgehog signaling, and essential for ciliogenesis. Mutations in this gene are associated with Meckel syndrome type 8. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms C12orf38; JBTS24; MKS8; TECT2
Note Human: 100%; Pig: 92%; Horse: 92%; Rat: 77%; Mouse: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.