TCTN2 Rabbit Polyclonal Antibody

CAT#: TA330754

Rabbit Polyclonal Anti-TCTN2 Antibody

Product Images

Host: Rabbit; Target Name: TCTN2; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TCTN2 antibody is: synthetic peptide directed towards the N-terminal region of Human TCTN2. Synthetic peptide located within the following region: VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: tectonic family member 2
• Database Link:
  NP_001137322
  Entrez Gene 79867 Human
  UniProt ID Q96GX1
• Background: This gene encodes a type I membrane protein that belongs to the tectonic family. Studies in mice suggest that this protein may be involved in hedgehog signaling, and essential for ciliogenesis. Mutations in this gene are associated with Meckel syndrome type 8. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: C12orf38; JBTS24; MKS8; TECT2
• Note: Human: 100%; Pig: 92%; Horse: 92%; Rat: 77%; Mouse: 77%