SOHLH2 Rabbit Polyclonal Antibody

CAT#: TA330852

Rabbit Polyclonal Anti-SOHLH2 Antibody

Product Images

Host: Rabbit; Target Name: SOHLH2; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SOHLH2 antibody is: synthetic peptide directed towards the N-terminal region of Human SOHLH2. Synthetic peptide located within the following region: MSQGSGLHQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKAKIDILLVGD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: spermatogenesis and oogenesis specific basic helix-loop-helix 2
• Database Link:
  NP_060296
  Entrez Gene 54937 Human
• Background: SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis.
• Synonyms: bHLHe81; SOSF2; SPATA28; TEB1
• Note: Human: 100%; Dog: 92%; Pig: 83%; Rat: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Transcription Factors