RTL8A Rabbit Polyclonal Antibody

CAT#: TA330867

Rabbit Polyclonal Anti-FAM127B Antibody

Product Images

Host: Rabbit; Target Name: FAM127B; Sample Tissue: MDA-MB-435s Whole Cell lysates; Antibody Dilution: 1.0ug/ml; FAM127B is supported by BioGPS gene expression data to be expressed in MDA-MB435

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM127B antibody is: synthetic peptide directed towards the N-terminal region of Human FAM127B. Synthetic peptide located within the following region: GRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: family with sequence similarity 127 member B
• Database Link:
  NP_001071640
  Entrez Gene 26071 Human
  UniProt ID Q9BWD3
• Background: The function of this protein remains unknown.
• Synonyms: CXX1b; MAR8A
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Rat: 79%