HOXC13 Rabbit Polyclonal Antibody

CAT#: TA330916

Rabbit Polyclonal Anti-HOXC13 Antibody

Product Images

Host: Rabbit; Target Name: HOXC13; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HOXC13 antibody is: synthetic peptide directed towards the middle region of Human HOXC13. Synthetic peptide located within the following region: QQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: homeobox C13
• Database Link:
  NP_059106
  Entrez Gene 3229 Human
  UniProt ID P31276
• Background: HOXC13 is a transcription factor which plays a role in hair follicle differentiation. It regulates FOXQ1 expression and that of other hair-specific genes
• Synonyms: ECTD9; HOX3; HOX3G
• Note: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors