ASMT Rabbit Polyclonal Antibody

CAT#: TA330919

Rabbit Polyclonal Anti-ASMT Antibody

Product Images

Host: Rabbit; Target Name: ASMT; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ASMT antibody is: synthetic peptide directed towards the N-terminal region of Human ASMT. Synthetic peptide located within the following region: VRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: acetylserotonin O-methyltransferase
• Database Link:
  NP_004034
  Entrez Gene 438 Human
  UniProt ID P46597
• Background: This gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene.
• Synonyms: ASMTY; HIOMT; HIOMTY
• Note: Human: 100%; Horse: 92%; Dog: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Tryptophan metabolism