NEU2 Rabbit Polyclonal Antibody

CAT#: TA330920

Rabbit Polyclonal Anti-NEU2 Antibody

Product Images

Host: Rabbit; Target Name: NEU2; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: neuraminidase 2 (cytosolic sialidase)
• Database Link:
  NP_005374
  Entrez Gene 4759 Human
  UniProt ID Q9Y3R4
• Background: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.
• Synonyms: SIAL2
• Note: Human: 100%; Pig: 79%; Dog: 77%

Reference Data

• Protein Pathways: Other glycan degradation, Sphingolipid metabolism