ANKRD15 (KANK1) Rabbit Polyclonal Antibody

CAT#: TA330933

Rabbit polyclonal Anti-KANK1 Antibody

Product Images

Host: Rabbit; Target Name: KANK1; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KANK1 antibody is: synthetic peptide directed towards the C-terminal region of Human KANK1. Synthetic peptide located within the following region: STALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: KN motif and ankyrin repeat domains 1
• Database Link:
  NP_694856
  Entrez Gene 23189 Human
  UniProt ID Q14678
• Background: The function of this protein remains unknown.
• Synonyms: ANKRD15; CPSQ2; KANK
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Dog: 86%; Guinea pig: 86%