LYSMD2 Rabbit Polyclonal Antibody

CAT#: TA330943

Rabbit polyclonal Anti-LYSMD2 Antibody

Product Images

WB Suggested Anti-LYSMD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYSMD2 antibody: synthetic peptide directed towards the middle region of human LYSMD2. Synthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: LysM domain containing 2
• Database Link:
  NP_699205
  Entrez Gene 256586 Human
  UniProt ID Q8IV50
• Background: The specific function of the protein remains unknown.
• Synonyms: DKFZp686I2243; MGC35274
• Note: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 79%; Guinea pig: 79%