METTL7B Rabbit Polyclonal Antibody

CAT#: TA330981

Rabbit polyclonal Anti-METTL7B Antibody

Product Images

WB Suggested Anti-METTL7B Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METTL7B antibody: synthetic peptide directed towards the middle region of human METTL7B. Synthetic peptide located within the following region: FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: methyltransferase like 7B
• Database Link:
  NP_689850
  Entrez Gene 196410 Human
  UniProt ID Q6UX53
• Background: METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.
• Synonyms: ALDI
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Horse: 92%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane