AER61 (EOGT) Rabbit Polyclonal Antibody

CAT#: TA330995

Rabbit polyclonal Anti-C3orf64 Antibody

Product Images

WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C3orf64 antibody: synthetic peptide directed towards the C terminal of human C3orf64. Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: EGF domain specific O-linked N-acetylglucosamine transferase
• Database Link:
  NP_775925
  Entrez Gene 285203 Human
  UniProt ID Q5NDL2
• Background: The exact function of C3orf64 remains unknown.
• Synonyms: AER61; AOS4; C3orf64; EOGT1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%