Pigw Rabbit Polyclonal Antibody

CAT#: TA331010

Rabbit polyclonal Anti-Pigw Antibody

Product Images

WB Suggested Anti-Pigw Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Rat Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pigw antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: phosphatidylinositol glycan anchor biosynthesis, class W
• Database Link:
  NP_919443
  Entrez Gene 378774 Rat
  UniProt ID Q7TSN4
• Background: Pigw is a probable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI-anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins
• Synonyms: FLJ37433; Gwt1; PIG-W
• Note: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Yeast: 91%; Mouse: 86%; Bovine: 86%; Zebrafish: 83%