Pigw Rabbit Polyclonal Antibody

CAT#: TA331010

Rabbit polyclonal Anti-Pigw Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Pigw"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Pigw antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name phosphatidylinositol glycan anchor biosynthesis, class W
Background Pigw is a probable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI-anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins
Synonyms FLJ37433; Gwt1; PIG-W
Note Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Yeast: 91%; Mouse: 86%; Bovine: 86%; Zebrafish: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.