PIGW Rabbit Polyclonal Antibody

CAT#: TA331011

Rabbit polyclonal Anti-PIGW Antibody

Product Images

WB Suggested Anti-PIGW Antibody Titration: 0.2-1 ug/ml; Positive Control: NTERA2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIGW antibody: synthetic peptide directed towards the middle region of human PIGW. Synthetic peptide located within the following region: IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: phosphatidylinositol glycan anchor biosynthesis class W
• Database Link:
  NP_848612
  Entrez Gene 284098 Human
  UniProt ID Q7Z7B1
• Background: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol.Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-430 AK094752.1 1-430 431-1570 AB097818.1 376-1515 1571-2255 AK094752.1 1571-2255
• Synonyms: Gwt1; HPMRS5
• Note: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways