TRPV5 Rabbit Polyclonal Antibody

CAT#: TA331092

Rabbit polyclonal Anti-TRPV5 Antibody

Product Images

Sample Type: 1-4. hRetinal pigment epithelial cells, 4 individual donors (20ug); Primary Dilution: 1:1000; Secondary Antibody: goat anti-rabbit-AP; Secondary Dilution: 1:2000; Image Submitted by: Brian Kennedy; Indiana University Northwest See Customer Fe

• 

  WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate; TRPV5 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Sample Type: hRetinal pigment epithelial cells; Green: primary; Red: nuclear; Primary Dilution: 1:200; Secondary Antibody: goat anti-rabbit-Alexa 488; Secondary Dilution: 1:500; Image Submitted by: Brian Kennedy; Indiana University Northwest See Customer

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: transient receptor potential cation channel subfamily V member 5
• Database Link:
  NP_062815
  Entrez Gene 56302 Human
  UniProt ID Q9NQA5
• Background: TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2486 AF304464.1 86-2571
• Synonyms: CAT2; ECAC1; OTRPC3
• Note: Human: 100%; Pig: 92%; Dog: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Horse: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane