Nuclear Factor 1 (NFIA) Rabbit Polyclonal Antibody

CAT#: TA331120

Rabbit Polyclonal Anti-NFIA Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NFIA"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NFIA antibody: synthetic peptide directed towards the middle region of human NFIA. Synthetic peptide located within the following region: QHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 55 kDa
Gene Name nuclear factor I A
Background Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization. [supplied by OMIM]
Synonyms A; CTF; NF-I; NF1-A; NFI-A; NFI-L
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.