PAX3 Rabbit Polyclonal Antibody

CAT#: TA331132

Rabbit Polyclonal Anti-PAX3 Antibody

Product Images

WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Lung

• 

  WB Suggested Anti-PAX3 Antibody ; Positive Control: Lane 1: Flag-PAX3 (overexpression, human), HEK293, 50?g. Lane 2: Mouse, B16F10, 50?g. Lane 3: Human, A375, 50?g. Lane 4: Human, A2058, 50?g; Primary Antibody Dilution : 1:5000; Secondary Antibody : Goat a

• 

  Sample Type : Mouse B16F10Primary Antibody Dilution : 1:200Secondary Antibody : Goat anti-rabbit-FITCSecondary Antibody Dilution : 1:800Color/Signal Descriptions : Green: FITC Blue: DAPIGene Name : PAX3Submitted by : Tsu Fang Wu, Institute of Molecular Bi

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: paired box 3
• Database Link:
  NP_852122
  Entrez Gene 18505 MouseEntrez Gene 5077 Human
  UniProt ID P23760
• Background: PAX3 is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma.This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.
• Synonyms: CDHS; HUP2; WS1; WS3
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors