ACSL1 Rabbit Polyclonal Antibody

CAT#: TA331164

Rabbit Polyclonal Anti-ACSL1 Antibody

Product Images

WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Human Hela

• 

  Hum. Fetal Brain

• 

  Human 721_B cellsACSL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Human kidney

• 

  heart, liver, pancreas, brain

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: acyl-CoA synthetase long-chain family member 1
• Database Link:
  NP_001986
  Entrez Gene 2180 Human
  UniProt ID P33121
• Background: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ACS1; FACL1; FACL2; LACS; LACS1; LACS2
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Horse: 85%; Pig: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway