ACSL1 Rabbit Polyclonal Antibody

CAT#: TA331165

Rabbit Polyclonal Anti-ACSL1 Antibody

Product Images

WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate

• 

  Researcher: Received from anonymous; Application: IHC; Species+tissue/cell type:THP-1 derived macrophage; Primary antibody dilution: 1:200; Secondary antibody: Goat anti-rabbit Alexa Fluor 647; Secondary antibody dilution:1:333

• 

  Researcher: Received from anonymous; Application: IHC; Species+tissue/cell type:THP-1 derived macrophage activated with iMtb; Primary antibody dilution: Primary ab dil: 1:200; Secondary antibody: Goat anti-rabbit Alexa Fluor 647; Secondary antibody diluti

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: acyl-CoA synthetase long-chain family member 1
• Database Link:
  NP_001986
  Entrez Gene 2180 Human
  UniProt ID P33121
• Background: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ACS1; FACL1; FACL2; LACS; LACS1; LACS2
• Note: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Rat: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Horse: 79%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway