ACSL1 Rabbit Polyclonal Antibody
Other products for "ACSL1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | IHC, WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 78 kDa |
Gene Name | acyl-CoA synthetase long-chain family member 1 |
Database Link | |
Background | ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | ACS1; FACL1; FACL2; LACS; LACS1; LACS2 |
Note | Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Rat: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Horse: 79%; Zebrafish: 77% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.