ME1 Rabbit Polyclonal Antibody

CAT#: TA331171

Rabbit Polyclonal Anti-ME1 Antibody

Product Images

Host: Rabbit; Target Name: ME1; Sample Tissue: Lymph Node Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ME1 antibody is: synthetic peptide directed towards the C-terminal region of Human ME1. Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: malic enzyme 1
• Database Link:
  NP_002386
  Entrez Gene 4199 Human
  UniProt ID P48163
• Background: The function of this protein remains unknown.
• Synonyms: HUMNDME; MES
• Note: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Goat: 85%; Sheep: 85%; Bovine: 85%; Mouse: 77%

Reference Data

• Protein Pathways: Metabolic pathways, PPAR signaling pathway, Pyruvate metabolism