KAT7 Rabbit Polyclonal Antibody

CAT#: TA331195

Rabbit Polyclonal Anti-MYST2 Antibody

Product Images

WB Suggested Anti-MYST2 Antibody Titration: 0.2-1 ug/ml; Positive Control: 293T cell lysateKAT7 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: lysine acetyltransferase 7
• Database Link:
  NP_008998
  Entrez Gene 11143 Human
  UniProt ID O95251
• Background: MYST2 belongs to the MYST family, which is characterized by a highly conserved C2HC zinc finger and a putative histone acetyltransferase domain. MYST2 specifically represses AR-mediated transcription. MYST2 is a new AR-interacting protein capable of modulating AR activity. It could play a significant role in regulating AR-dependent genes in normal and prostate cancer cells. The biochemical and genetic interactions of MYST family protein MYST2 with two components of the replication apparatus, MCM2 and ORC1, suggest that MYST2-associated HAT activity may play a direct role in the process of DNA replication. MYST2 is a positive regulatory factor for prereplicative complex assembly.
• Synonyms: HBO1; HBOA; MYST2; ZC2HC7
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors