Noelin (OLFM1) Rabbit Polyclonal Antibody

CAT#: TA331216

Rabbit Polyclonal Anti-OLFM1 Antibody

Product Images

WB Suggested Anti-OLFM1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the N-terminal region of Human OLFM1. Synthetic peptide located within the following region: VLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: olfactomedin 1
• Database Link:
  NP_055094
  Entrez Gene 10439 Human
  UniProt ID Q99784
• Background: This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene.
• Synonyms: AMY; NOE1; NOELIN1; OlfA
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome