PDGFRL Rabbit Polyclonal Antibody

CAT#: TA331218

Rabbit Polyclonal Anti-PDGFRL Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PDGFRL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PDGFRL antibody is: synthetic peptide directed towards the N-terminal region of Human PDGFRL. Synthetic peptide located within the following region: KVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name platelet derived growth factor receptor like
Background This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor.
Synonyms PDGRL; PRLTS
Note Human: 100%; Pig: 79%; Rat: 79%; Horse: 79%; Bovine: 75%
Reference Data
Protein Families Druggable Genome, Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.