SPAG16 Rabbit Polyclonal Antibody

CAT#: TA331230

Rabbit Polyclonal Anti-SPAG16 Antibody

Product Images

Host: Rabbit; Target Name: SPAG16; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPAG16 antibody is: synthetic peptide directed towards the N-terminal region of Human SPAG16. Synthetic peptide located within the following region: LENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: sperm associated antigen 16
• Database Link:
  NP_078808
  Entrez Gene 79582 Human
  UniProt ID Q8N0X2
• Background: Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively.
• Synonyms: PF20; WDR29
• Note: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 79%