ADI1 Rabbit Polyclonal Antibody

CAT#: TA331241

Rabbit Polyclonal Anti-ADI1 Antibody

Product Images

WB Suggested Anti-ADI1 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADI1. Synthetic peptide located within the following region: YMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: acireductone dioxygenase 1
• Database Link:
  NP_060739
  Entrez Gene 55256 Human
  UniProt ID Q9BV57
• Background: This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20.
• Synonyms: APL1; ARD; Fe-ARD; HMFT1638; MTCBP1; mtnD; Ni-ARD; SIPL
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 92%; Guinea pig: 83%; Zebrafish: 79%

Reference Data

• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways