ADI1 Rabbit Polyclonal Antibody

CAT#: TA331242

Rabbit Polyclonal Anti-ADI1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ADI1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ADI1 antibody is: synthetic peptide directed towards the middle region of Human ADI1. Synthetic peptide located within the following region: DKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 21 kDa
Gene Name acireductone dioxygenase 1
Background This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20.
Synonyms APL1; ARD; Fe-ARD; HMFT1638; MTCBP1; mtnD; Ni-ARD; SIPL
Note Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Goat: 79%; Yeast: 79%
Reference Data
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.