G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody

CAT#: TA331256

Rabbit Polyclonal Anti-GNA13 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GNA13"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name G protein subunit alpha 13
Background Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Synonyms G13
Note Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%
Reference Data
Protein Families Druggable Genome
Protein Pathways Long-term depression, Regulation of actin cytoskeleton, Vascular smooth muscle contraction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.