RAB7L1 (RAB29) Rabbit Polyclonal Antibody

CAT#: TA331289

Rabbit Polyclonal Anti-RAB7L1 Antibody

Product Images

WB Suggested Anti-RAB7L1 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole CellRAB7L1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RAB7L1 antibody is: synthetic peptide directed towards the N-terminal region of Human RAB7L1. Synthetic peptide located within the following region: RDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGGQERFTSMTRLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: RAB29, member RAS oncogene family
• Database Link:
  NP_001129135
  Entrez Gene 8934 Human
  UniProt ID O14966
• Background: The function of this protein remains unknown.
• Synonyms: RAB7L; RAB7L1
• Note: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome