Spaca3 Rabbit Polyclonal Antibody

CAT#: TA331299

Rabbit Polyclonal Anti-Spaca3 Antibody

Product Images

Host: Rabbit; Target Name: Spaca3; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Spaca3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Spaca3. Synthetic peptide located within the following region: RIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: sperm acrosome associated 3
• Database Link:
  NP_083643
  Entrez Gene 75622 Mouse
  UniProt ID Q9D9X8
• Background: Spaca3 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitro?
• Synonyms: 1700025M08Rik; ALLP17; CT54; LYC3; LYZL3; MGC119058; SLLP1; SPRASA
• Note: Horse: 100%; Human: 100%; Pig: 93%; Rat: 92%; Dog: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 79%